CXCR7/RDC-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP258162

Catalog No. NBP258162

Description

CXCR7/RDC-1 Polyclonal specifically detects CXCR7/RDC-1 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CXCR7/RDC-1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: chemokine (C-X-C motif) receptor 7, Chemokine orphan receptor 1CMKOR1C-X-C chemokine receptor type 7, CXC-R7, CXCR-7, G protein-coupled receptor, GPR159G-protein coupled receptor 159, RDC-1, RDC1G-protein coupled receptor RDC1 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ACKR3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
• Quantity: 100 μL
• Research Discipline: Chemokines and Cytokines, GPCR
• Gene ID (Entrez): 57007
• Target Species: Human, Mouse
• Isotype: IgG

For Research Use Only