Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CXorf40A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00

Specifications

Antigen	CXorf40A
Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB396288 View Documents View Product Certificates	Novus Biologicals NBP24685925UL	25 μL	Each of 1 for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CXorf40A Polyclonal antibody specifically detects CXorf40A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	CXorf40A
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q8TE69
Gene ID (Entrez)	91966
Isotype	IgG
Purification Method	Immunogen affinity purified

Dilution	Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS (pH 7.2), 40% Glycerol
Gene Alias	chromosome X open reading frame 40, chromosome X open reading frame 40A, CXorf40, EOLA1, EOLA1Endothelial-overexpressed lipopolysaccharide-associated factor 1, FLJ52212, protein CXorf40A
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: YAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWE
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CXorf40A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents