Cyclin B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256867

Catalog No. NBP256867

Description

Cyclin B1 Polyclonal specifically detects Cyclin B1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cyclin B1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CCNB, cyclin B1, G2/mitotic-specific cyclin B1, G2/mitotic-specific cyclin-B1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CCNB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDK
• Quantity: 100 μL
• Research Discipline: Cancer, Cell Biology, Cell Cycle and Replication, Mitotic Regulators, Tumor Suppressors
• Gene ID (Entrez): 891
• Target Species: Human
• Isotype: IgG

For Research Use Only