Cyclin D2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25878325UL

Catalog No. NB393278

Description

Cyclin D2 Polyclonal specifically detects Cyclin D2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Cyclin D2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: cyclin D2, G1/S-specific cyclin D2, G1/S-specific cyclin-D2, KIAK0002, MGC102758
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CCND2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATW
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Ovarian Carcinoma Cell Markers, Stem Cell Markers, Wnt Signaling Pathway
• Gene ID (Entrez): 894
• Target Species: Human
• Isotype: IgG

For Research Use Only