Cyclin T1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31723825UL

Catalog No. NB169553

Description

Cyclin T1 Polyclonal antibody specifically detects Cyclin T1 in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: Cyclin T1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: CCNT, CCNT1, CCNTcyclin-T, CDK9-associated C-type protein, cyclin C-related protein, cyclin T1, cyclin T1b, Cyclin-T, cyclin-T1, CYCT1, HIVE1, human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1, Human immunodeficiency virus-1 expression, subunit of positive elongation transcription factor b
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSV
• Quantity: 25 μg
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 904
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified