Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Cyclin T2 Antibody, Novus Biologicals™

Cyclin T2 Antibody, Novus Biologicals™
SDP

Catalog No. NB431410 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB431410 25 μL
NBP187592 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB431410 Supplier Novus Biologicals Supplier No. NBP18759225UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Cyclin T2 Polyclonal specifically detects Cyclin T2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockout Validated.

Specifications

Antigen Cyclin T2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoassay
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot WB reported in scientific literature (PMID: 30209133)., Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockout Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias cyclin T2, cyclin T2a, cyclin T2b, cyclin-T2, CYCT2, FLJ13583, FLJ90560, MGC134840, SDS-stable vimentin-bound DNA fragment HEF42VIM22, subunit of positive elongation transcription factor b
Gene Symbols CCNT2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KAGSSKHHGPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTSPIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDEGSGKSKHSSPH
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 905
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.