Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cyclophilin B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162356
Description
Cyclophilin B Polyclonal specifically detects Cyclophilin B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Cyclophilin B | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Cyclophilin B, cyclophilin-like protein, CYPBEC 5.2.1.8, CYP-S1, MGC2224, OI9MGC14109, peptidyl-prolyl cis-trans isomerase B, peptidylprolyl isomerase B (cyclophilin B), PPIase B, Rotamase B, S-cyclophilin, SCYLP | |
| Rabbit | |
| 24 kDa | |
| 100 μL | |
| Primary | |
| Zebrafish: 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| A8K534 | |
| PPIB | |
| Synthetic peptides corresponding to PPIB(peptidylprolyl isomerase B (cyclophilin B)) The peptide sequence was selected from the C terminal of PPIB. Peptide sequence VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE. | |
| Protein A purified | |
| RUO | |
| 5479 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction