Cyclophilin B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162356

Catalog No. NBP162356

Description

Cyclophilin B Polyclonal specifically detects Cyclophilin B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cyclophilin B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cyclophilin B, cyclophilin-like protein, CYPBEC 5.2.1.8, CYP-S1, MGC2224, OI9MGC14109, peptidyl-prolyl cis-trans isomerase B, peptidylprolyl isomerase B (cyclophilin B), PPIase B, Rotamase B, S-cyclophilin, SCYLP
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: A8K534
• Gene Symbols: PPIB
• Immunogen: Synthetic peptides corresponding to PPIB(peptidylprolyl isomerase B (cyclophilin B)) The peptide sequence was selected from the C terminal of PPIB. Peptide sequence VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5479
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG