Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cyclophilin B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16235620UL
Description
Cyclophilin B Polyclonal specifically detects Cyclophilin B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Cyclophilin B | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
A8K534 | |
PPIB | |
Synthetic peptides corresponding to PPIB(peptidylprolyl isomerase B (cyclophilin B)) The peptide sequence was selected from the C terminal of PPIB. Peptide sequence VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE. | |
Protein A purified | |
RUO | |
5479 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Cyclophilin B, cyclophilin-like protein, CYPBEC 5.2.1.8, CYP-S1, MGC2224, OI9MGC14109, peptidyl-prolyl cis-trans isomerase B, peptidylprolyl isomerase B (cyclophilin B), PPIase B, Rotamase B, S-cyclophilin, SCYLP | |
Rabbit | |
24 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction