Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYLD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP233589
Description
CYLD Polyclonal specifically detects CYLD in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
CYLD | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Q9NQC7 | |
CYLD | |
This antibody was developed against a recombinant protein corresponding to amino acids: PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER | |
0.1 mL | |
Cancer, Cell Cycle and Replication | |
1540 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CDMT, CYLD1MFT, CYLDI, cylindromatosis (turban tumor syndrome), Deubiquitinating enzyme CYLD, EAC, EC 3.1.2.15, EC 3.4.19.12, FLJ20180, FLJ31664, KIAA0849FLJ78684, MFT1, probable ubiquitin carboxyl-terminal hydrolase CYLD, SBS, TEM, ubiquitin carboxyl-terminal hydrolase CYLD, ubiquitin specific peptidase like 2, ubiquitin thioesterase CYLD, Ubiquitin thiolesterase CYLD, Ubiquitin-specific-processing protease CYLD, USPL2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction