Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYLD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CYLD |
---|---|
Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CYLD Polyclonal specifically detects CYLD in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
CYLD | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q9NQC7 | |
1540 | |
This antibody was developed against a recombinant protein corresponding to amino acids: PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHINDIIPESVTQER | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Cancer, Cell Cycle and Replication | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CDMT, CYLD1MFT, CYLDI, cylindromatosis (turban tumor syndrome), Deubiquitinating enzyme CYLD, EAC, EC 3.1.2.15, EC 3.4.19.12, FLJ20180, FLJ31664, KIAA0849FLJ78684, MFT1, probable ubiquitin carboxyl-terminal hydrolase CYLD, SBS, TEM, ubiquitin carboxyl-terminal hydrolase CYLD, ubiquitin specific peptidase like 2, ubiquitin thioesterase CYLD, Ubiquitin thiolesterase CYLD, Ubiquitin-specific-processing protease CYLD, USPL2 | |
CYLD | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title