Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP154758

CYP11A1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154758 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154758 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154758 Supplier Novus Biologicals Supplier No. NBP154758
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CYP11A1 Polyclonal specifically detects CYP11A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CYP11A1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P05108
Gene Alias Cholesterol desmolase, cholesterol monooxygenase (side-chain-cleaving), cholesterol side-chain cleavage enzyme, mitochondrial, CYPXIA1, Cytochrome P450 11A1, Cytochrome P450(scc), cytochrome P450, family 11, subfamily A, polypeptide 1, cytochrome P450C11A1, EC 1.14.15, EC 1.14.15.6, steroid 20-22-lyase, subfamily XIA (cholesterol side chain cleavage)
Gene Symbols CYP11A1
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CYP11A1. Peptide Sequence LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW. The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 57 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 1583
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.