Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CYP11B2 Antibody, Novus Biologicals™

CYP11B2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP213891 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP213891 0.1 mL
NB438213 25ul
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP213891 Supplier Novus Biologicals Supplier No. NBP213891
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

CYP11B2 Polyclonal specifically detects CYP11B2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CYP11B2
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.2mg/mL
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ALDOSCYP11B, Aldosterone synthase, Aldosterone-synthesizing enzyme, CPN2, CYP11BL, CYPXIB2, cytochrome P450 11B2, mitochondrial, cytochrome P450, family 11, subfamily B, polypeptide 2, cytochrome P450, subfamily XIB (steroid 11-beta-hydroxylase), polypeptide 2, Cytochrome P-450Aldo, Cytochrome P-450C18, EC 1.14.15, EC 1.14.15.4, EC 1.14.15.5, mitochondrial cytochrome P450, family 11, subfamily B, polypeptide 2, P450aldo, P450C18, P-450C18, steroid 11-beta/18-hydroxylase, steroid 11-beta-monooxygenase, Steroid 18-hydroxylase, steroid 18-hydroxylase, aldosterone synthase, P450C18, P450aldo
Gene Symbols CYP11B2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCL
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 1585
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.