CYP21A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238698

Catalog No. NBP238698

Description

CYP21A2 Polyclonal specifically detects CYP21A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CYP21A2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P08686
• Gene Symbols: CYP21A2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 1589
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 21-OHase, CA21HCYP21B, CAH1, CPS1, CYP21EC 1.14.99.10, Cytochrome P450 21, Cytochrome P450 XXI, cytochrome P450, family 21, subfamily A, polypeptide 2, cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenalhyperplasia), polypeptide 2, Cytochrome P-450c21, Cytochrome P450-C21, Cytochrome P450-C21B, EC 1.14.99, MGC150536, MGC150537, P450c21B, steroid 21-hydroxylase, steroid 21-monooxygenase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.