Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP21A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | CYP21A2 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CYP21A2 Polyclonal specifically detects CYP21A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CYP21A2 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
21-OHase, CA21HCYP21B, CAH1, CPS1, CYP21EC 1.14.99.10, Cytochrome P450 21, Cytochrome P450 XXI, cytochrome P450, family 21, subfamily A, polypeptide 2, cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenalhyperplasia), polypeptide 2, Cytochrome P-450c21, Cytochrome P450-C21, Cytochrome P450-C21B, EC 1.14.99, MGC150536, MGC150537, P450c21B, steroid 21-hydroxylase, steroid 21-monooxygenase | |
CYP21A2 | |
IgG | |
Affinity Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P08686 | |
1589 | |
This antibody was developed against a recombinant protein corresponding to amino acids: LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title