CYP2S1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255469

Catalog No. NBP255469

Description

CYP2S1 Polyclonal specifically detects CYP2S1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CYP2S1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CYPIIS1, cytochrome P450 2S1, cytochrome P450 family member predicted from ESTs, cytochrome P450, family 2, subfamily S, polypeptide 1, cytochrome P450, subfamily IIS, polypeptide 1, cytochrome P540, subfamily IIS, polypeptide 1, EC 1.14.14.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CYP2S1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 29785
• Target Species: Human
• Isotype: IgG

For Research Use Only