CYP3A43 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169370

Catalog No. NBP169370

Description

CYP3A43 Polyclonal specifically detects CYP3A43 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CYP3A43
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cytochrome P450 3A43, cytochrome P450 polypeptide 43, cytochrome P450, family 3, subfamily A, polypeptide 43, cytochrome P450, subfamily IIIA, polypeptide 43, EC 1.14.14.1, MGC119315, MGC119316
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism, Prostate Cancer
• Gene ID (Entrez): 64816
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9HB55
• Gene Symbols: CYP3A43
• Immunogen: Synthetic peptides corresponding to CYP3A43(cytochrome P450, family 3, subfamily A, polypeptide 43) The peptide sequence was selected from the middle region of CYP3A43. Peptide sequence ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Canine: 79%; Porcine: 79%; Rat: 79%; Sheep: 79%; Bovine: 79%; Guinea pig: 79%.
• Target Species: Human, Rat, Bovine, Canine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

For Research Use Only