Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CYP3A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162387
Description
CYP3A7 Polyclonal specifically detects CYP3A7 in Human samples. It is validated for Western Blot.Specifications
CYP3A7 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CYPIIIA7, cytochrome P450, family 3, subfamily A, polypeptide 7, Cytochrome P450-HFLA, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, subfamily IIIA, polypeptide 7, xenobiotic monooxygenase | |
Rabbit | |
57 kDa | |
100 μL | |
Lipid and Metabolism | |
1551 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
P24462 | |
CYP3A7 | |
Synthetic peptides corresponding to CYP3A7(cytochrome P450, family 3, subfamily A, polypeptide 7) The peptide sequence was selected from the middle region of CYP3A7. Peptide sequence KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI. | |
Protein A purified | |
RUO | |
Primary | |
Rat: 85%; Porcine: 83%; Guinea pig: 83%; Bovine: 77%; Canine: 75%. | |
Human, Rat, Bovine, Canine, Guinea Pig | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction