Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CYP3A7 Antibody, Novus Biologicals™

CYP3A7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16238720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16238720 20 μL
NBP162387 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16238720 Supplier Novus Biologicals Supplier No. NBP16238720UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

CYP3A7 Polyclonal specifically detects CYP3A7 in Human samples. It is validated for Western Blot.

Specifications

Antigen CYP3A7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P24462
Gene Alias CYPIIIA7, cytochrome P450, family 3, subfamily A, polypeptide 7, Cytochrome P450-HFLA, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, subfamily IIIA, polypeptide 7, xenobiotic monooxygenase
Gene Symbols CYP3A7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CYP3A7(cytochrome P450, family 3, subfamily A, polypeptide 7) The peptide sequence was selected from the middle region of CYP3A7. Peptide sequence KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI.
Molecular Weight of Antigen 57 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 1551
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.