Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CYP4F12 Antibody, Novus Biologicals™

CYP4F12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP162396 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP162396 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP162396 Supplier Novus Biologicals Supplier No. NBP162396
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CYP4F12 Polyclonal specifically detects CYP4F12 in Human samples. It is validated for Western Blot.

Specifications

Antigen CYP4F12
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9HCS2
Gene Alias CYPIVF12, cytochrome P450 4F12, cytochrome P450, family 4, subfamily F, polypeptide 12, cytochrome P450, subfamily IVF, polypeptide 12, EC 1.14.14.1, F22329_1
Gene Symbols CYP4F12
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CYP4F12(cytochrome P450, family 4, subfamily F, polypeptide 12) The peptide sequence was selected from the C terminal of CYP4F12. Peptide sequence TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV.
Molecular Weight of Antigen 60 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 66002
Test Specificity Canine: 86%; equine: 86%; Mouse: 86%; Sheep: 86%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.