Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CYP4F12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	CYP4F12
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP162396 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP162396	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

CYP4F12 Polyclonal specifically detects CYP4F12 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CYP4F12
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Lipid and Metabolism
Gene Alias	CYPIVF12, cytochrome P450 4F12, cytochrome P450, family 4, subfamily F, polypeptide 12, cytochrome P450, subfamily IVF, polypeptide 12, EC 1.14.14.1, F22329_1
Gene Symbols	CYP4F12
Isotype	IgG
Molecular Weight of Antigen	60 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9HCS2
Gene ID (Entrez)	66002
Immunogen	Synthetic peptides corresponding to CYP4F12(cytochrome P450, family 4, subfamily F, polypeptide 12) The peptide sequence was selected from the C terminal of CYP4F12. Peptide sequence TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CYP4F12 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents