Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CYP51A1 Antibody, Novus Biologicals™

CYP51A1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179790 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179790 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179790 Supplier Novus Biologicals Supplier No. NBP179790
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CYP51A1 Polyclonal specifically detects CYP51A1 in Human samples. It is validated for Western Blot.

Specifications

Antigen CYP51A1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_000777
Gene Alias CP51, CYP51Cytochrome P450LI, CYPL1, CYPLI, Cytochrome P450 51A1, cytochrome P450, family 51, subfamily A, polypeptide 1, Cytochrome P450-14DM, EC 1.14.13.70, lanosterol 14-alpha demethylase, lanosterol 14-alpha-demethylase, LDMCytochrome P45014DM, P450-14DM, P450L1,51 (lanosterol 14-alpha-demethylase), Sterol 14-alpha demethylase
Gene Symbols CYP51A1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human CYP51A1The immunogen for this antibody is CYP51A1. Peptide sequence TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ.
Molecular Weight of Antigen 57 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Cellular Signaling, metabolism
Primary or Secondary Primary
Gene ID (Entrez) 1595
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.