Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CYP51A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	CYP51A1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179790 View Documents View Product Certificates	Novus Biologicals NBP179790	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CYP51A1 Polyclonal specifically detects CYP51A1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CYP51A1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_000777
Gene ID (Entrez)	1595
Immunogen	Synthetic peptide directed towards the N terminal of human CYP51A1The immunogen for this antibody is CYP51A1. Peptide sequence TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	CP51, CYP51Cytochrome P450LI, CYPL1, CYPLI, Cytochrome P450 51A1, cytochrome P450, family 51, subfamily A, polypeptide 1, Cytochrome P450-14DM, EC 1.14.13.70, lanosterol 14-alpha demethylase, lanosterol 14-alpha-demethylase, LDMCytochrome P45014DM, P450-14DM, P450L1,51 (lanosterol 14-alpha-demethylase), Sterol 14-alpha demethylase
Gene Symbols	CYP51A1
Isotype	IgG
Molecular Weight of Antigen	57 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CYP51A1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents