Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP152849

Cystathionase Antibody, Novus Biologicals™
SDP

Catalog No. NBP152849 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP152849 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP152849 Supplier Novus Biologicals Supplier No. NBP152849
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 4 publications

Cystathionase Polyclonal specifically detects Cystathionase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

Antigen Cystathionase
Applications Western Blot, Immunoprecipitation
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunoprecipitation
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P32929
Gene Alias cystathionase (cystathionine gamma-lyase), cystathionine gamma-lyase, cysteine desulfhydrase, EC 4.4.1, EC 4.4.1.1, gamma-cystathionase, homoserine deaminase, homoserine dehydratase, MGC9471
Gene Symbols CTH
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CTH(cystathionase (cystathionine gamma-lyase)) The peptide sequence was selected from the N terminal of human CTH. Peptide sequence VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF.
Molecular Weight of Antigen 44 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1491
Test Specificity Expected identity based on immunogen sequence: Xenopus: 84%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.