Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cystatin-8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157663
Description
Cystatin-8 Polyclonal specifically detects Cystatin-8 in Human samples. It is validated for Western Blot.Specifications
| Cystatin-8 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CRESCystatin-related epididymal spermatogenic protein, cystatin 8 (cystatin-related epididymal specific), cystatin-8, cystatin-related epididymal-specific | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10047 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O60676 | |
| CST8 | |
| Synthetic peptides corresponding to CST8(cystatin 8 (cystatin-related epididymal specific)) The peptide sequence was selected from the middle region of CST8. Peptide sequence LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 100%; Canine: 92%; Pig: 91%; Bovine: 90%; Rabbit: 85%; Rat: 84%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction