Cystatin E/M/CST6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169005

Catalog No. NBP169005

Description

Cystatin E/M/CST6 Polyclonal specifically detects Cystatin E/M/CST6 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Cystatin E/M/CST6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cystatin 6, cystatin E/M, cystatin M, cystatin M/E, Cystatin-6, Cystatin-E, cystatin-M, cysteine proteinase inhibitor
• Host Species: Rabbit
• Molecular Weight of Antigen: 16 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%; Guinea pig: 86%; Mouse: 79%; Bovine: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9D1B1
• Gene Symbols: CST6
• Immunogen: Synthetic peptides corresponding to Cst6 (cystatin E/M) The peptide sequence was selected from the middle region of Cst6. Peptide sequence CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1474
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.