Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cystatin E/M/CST6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Cystatin E/M/CST6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Cystatin E/M/CST6 Polyclonal specifically detects Cystatin E/M/CST6 in Mouse samples. It is validated for Western Blot.Specifications
Cystatin E/M/CST6 | |
Polyclonal | |
Rabbit | |
Q9D1B1 | |
1474 | |
Synthetic peptides corresponding to Cst6 (cystatin E/M) The peptide sequence was selected from the middle region of Cst6. Peptide sequence CGELIPPPPPSYRLSLTLTSPLSTAAKELVLIPLHAAPNQAVAEIDALYD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
cystatin 6, cystatin E/M, cystatin M, cystatin M/E, Cystatin-6, Cystatin-E, cystatin-M, cysteine proteinase inhibitor | |
CST6 | |
IgG | |
16 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title