Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CYTIP Antibody, Novus Biologicals™

CYTIP Antibody, Novus Biologicals™
SDP

Catalog No. NB431012 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB431012 25 μL
NBP188946 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB431012 Supplier Novus Biologicals Supplier No. NBP18894625UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CYTIP Polyclonal specifically detects CYTIP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen CYTIP
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias B3-1, CASPCytohesin-associated scaffolding protein, Cbp HE, CYBRCytohesin-binding protein HE, CYTHIP, cytohesin 1 interacting protein, Cytohesin binder and regulator, cytohesin-1 interacting protein, cytohesin-interacting protein, HEPleckstrin homology Sec7 and coiled-coil domains-binding protein, pleckstrin homology, Sec7 and coiled/coil domains, binding protein, pleckstrin homology, Sec7 and coiled-coil domains, binding protein, PSCDBPcytohesin binding protein HE
Gene Symbols CYTIP
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDFSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGF
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9595
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.