Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytochrome P450 2C9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18548825UL
Description
Cytochrome P450 2C9 Polyclonal specifically detects Cytochrome P450 2C9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Cytochrome P450 2C19 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
(R)-limonene 6-monooxygenase, (S)-limonene 6-monooxygenase, (S)-limonene 7-monooxygenase, CPCJ, CYP2C, CYPIIC17, CYPIIC19, cytochrome P450 2C19, cytochrome P-450 II C, cytochrome P450, family 2, subfamily C, polypeptide 19, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19, Cytochrome P450-11A, Cytochrome P450-254C, EC 1.14.13.48, EC 1.14.13.49, EC 1.14.13.80, EC 1.14.14.1, flavoprotein-linked monooxygenase, mephenytoin 4'-hydroxylase, Mephenytoin 4-hydroxylase, microsomal monooxygenase, P450C2C, P450IIC19, S-mephenytoin 4-hydroxylase, xenobiotic monooxygenase | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CYP2C19 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTST | |
25 μL | |
Lipid and Metabolism | |
1557 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction