Cytochrome P450 2C9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406555	Novus Biologicals NBP18548825UL	25 μL
NBP185488	Novus Biologicals NBP185488	0.1 mL

Description

Cytochrome P450 2C9 Polyclonal specifically detects Cytochrome P450 2C9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cytochrome P450 2C19
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: (R)-limonene 6-monooxygenase, (S)-limonene 6-monooxygenase, (S)-limonene 7-monooxygenase, CPCJ, CYP2C, CYPIIC17, CYPIIC19, cytochrome P450 2C19, cytochrome P-450 II C, cytochrome P450, family 2, subfamily C, polypeptide 19, cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19, Cytochrome P450-11A, Cytochrome P450-254C, EC 1.14.13.48, EC 1.14.13.49, EC 1.14.13.80, EC 1.14.14.1, flavoprotein-linked monooxygenase, mephenytoin 4'-hydroxylase, Mephenytoin 4-hydroxylase, microsomal monooxygenase, P450C2C, P450IIC19, S-mephenytoin 4-hydroxylase, xenobiotic monooxygenase
• Gene Symbols: CYP2C19
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Lipid and Metabolism
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1557
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTST
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only