Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP169423

Cytochrome P450 4F11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169423 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169423 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169423 Supplier Novus Biologicals Supplier No. NBP169423
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Cytochrome P450 4F11 Polyclonal specifically detects Cytochrome P450 4F11 in Human samples. It is validated for Western Blot.

Specifications

Antigen Cytochrome P450 4F11
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9HBI6
Gene Alias CYPIVF11, cytochrome P450 4F11, cytochrome P450, family 4, subfamily F, polypeptide 11, cytochrome P450, subfamily IVF, polypeptide 11, EC 1.14.14.1
Gene Symbols CYP4F11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CYP4F11(cytochrome P450, family 4, subfamily F, polypeptide 11) The peptide sequence was selected from the N terminal of CYP4F11. Peptide sequence FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI.
Molecular Weight of Antigen 58 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57834
Test Specificity Rat: 83%; Equine: 82%; Bovine: 82%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.