Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cytohesin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP19009725UL
Description
Cytohesin 3 Polyclonal specifically detects Cytohesin 3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Cytohesin 3 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
ARF nucleotide-binding site opener 3, ARNO3PH, SEC7 and coiled-coil domain-containing protein 3, cytohesin 3, General receptor of phosphoinositides 1, Grp1, GRP1cytohesin-3, pleckstrin homology, Sec7 and coiled-coil domains 3, Protein ARNO3, PSCD3pleckstrin homology, Sec7 and coiled/coil domains 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human Cytohesin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CYTH3 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:DEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAM | |
25 μL | |
Signal Transduction | |
9265 | |
Human, Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction