Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytokeratin 13 Antibody, Novus Biologicals™
SDP

Catalog No. NB436293 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436293 25 μL
NBP238166 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436293 Supplier Novus Biologicals Supplier No. NBP23816625UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Cytokeratin 13 Polyclonal specifically detects Cytokeratin 13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Cytokeratin 13
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P13646
Gene Alias CK13, CK-13, cytokeratin 13, Cytokeratin-13, K13cytokeratin-13, keratin 13, keratin, type I cytoskeletal 13, keratin-13, MGC161462, MGC3781
Gene Symbols KRT13
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cytoskeleton Markers
Primary or Secondary Primary
Gene ID (Entrez) 3860
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.