Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytokeratin 19 Antibody, Novus Biologicals™
SDP

Catalog No. NBP153204 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP153204 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP153204 Supplier Novus Biologicals Supplier No. NBP153204

Rabbit Polyclonal Antibody

Cytokeratin 19 Polyclonal specifically detects Cytokeratin 19 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Cytokeratin 19
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P08727
Gene Alias CK19, CK-19, cytokeratin 19, Cytokeratin-19,40-kDa keratin intermediate filament, K19cytokeratin-19, K1CS, keratin 19, keratin, type I cytoskeletal 19, keratin, type I, 40-kd, keratin-19, MGC15366
Gene Symbols KRT19
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KRT19(keratin 19) The peptide sequence was selected from the N terminal of KRT19. Peptide sequence TSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSAR.
Molecular Weight of Antigen 44 kDa
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Cellular Markers, Cytoskeleton Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3880
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.