Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytokeratin 20 Antibody (CL9390), Novus Biologicals™
SDP

Catalog No. NB036523 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB036523 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB036523 Supplier Novus Biologicals Supplier No. NBP288932
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Cytokeratin 20 Monoclonal specifically detects Cytokeratin 20 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Cytokeratin 20
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL9390
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, containing 40% glycerol
Gene Alias CD20, CK20, CK-20, cytokeratin-20, K20°Cytokeratin 20, keratin 20, keratin, type I cytoskeletal 20, keratin-20, KRT21, MGC35423, Protein IT
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Biology, Cellular Markers
Primary or Secondary Primary
Gene ID (Entrez) 54474
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.