Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154403

 View more versions of this product

Catalog No. NBP154403


Only null left
Add to Cart

Description

Description

Cytosolic Sulfotransferase 1B1/SULT1B1 Polyclonal specifically detects Cytosolic Sulfotransferase 1B1/SULT1B1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Cytosolic Sulfotransferase 1B1/SULT1B1
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, EC 2.8.2.4, MGC13356, ST1B1, ST1B2sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B1, Sulfotransferase 1B2, sulfotransferase family, cytosolic, 1B, member 1, SULT1B2, Thyroid hormone sulfotransferase
Rabbit
35 kDa
100 μL
metabolism
27284
Human, Pig, Bovine, Canine
IgG
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
O43704
SULT1B1
Synthetic peptides corresponding to SULT1B1(sulfotransferase family, cytosolic, 1B, member 1) The peptide sequence was selected from the N terminal of SULT1B1. Peptide sequence KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW.
Affinity purified
RUO
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.