Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP156977

Catalog No. NBP156977

Description

Cytosolic Sulfotransferase 1E1/SULT1E1 Polyclonal specifically detects Cytosolic Sulfotransferase 1E1/SULT1E1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cytosolic Sulfotransferase 1E1/SULT1E1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.8.2, EST-1, ESTMGC34459, estrone sulfotransferase, ST1E1, STEestrogen sulfotransferase, Sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, Sulfotransferase, estrogen-preferringEC 2.8.2.4
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 91%; Equine: 85%; Canine: 84%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: P49888
• Gene Symbols: SULT1E1
• Immunogen: Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Breast Cancer, Stem Cell Markers
• Gene ID (Entrez): 6783
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.