Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP15697720UL

Catalog No. NBP15697720

Description

Cytosolic Sulfotransferase 1E1/SULT1E1 Polyclonal specifically detects Cytosolic Sulfotransferase 1E1/SULT1E1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Cytosolic Sulfotransferase 1E1/SULT1E1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: P49888
• Gene Symbols: SULT1E1
• Immunogen: Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLF
• Quantity: 20 μL
• Research Discipline: Breast Cancer, Stem Cell Markers
• Gene ID (Entrez): 6783
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.8.2, EST-1, ESTMGC34459, estrone sulfotransferase, ST1E1, STEestrogen sulfotransferase, Sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, Sulfotransferase, estrogen-preferringEC 2.8.2.4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG