Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody, Novus Biologicals™

Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15697720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15697720 20 μL
NBP156977 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15697720 Supplier Novus Biologicals Supplier No. NBP15697720UL

Description

Rabbit Polyclonal Antibody has been used in 2 publications

Cytosolic Sulfotransferase 1E1/SULT1E1 Polyclonal specifically detects Cytosolic Sulfotransferase 1E1/SULT1E1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Cytosolic Sulfotransferase 1E1/SULT1E1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P49888
Gene Alias EC 2.8.2, EST-1, ESTMGC34459, estrone sulfotransferase, ST1E1, STEestrogen sulfotransferase, Sulfotransferase 1E1, sulfotransferase family 1E, estrogen-preferring, member 1, Sulfotransferase, estrogen-preferringEC 2.8.2.4
Gene Symbols SULT1E1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLF
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Breast Cancer, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6783
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.