Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody, Novus Biologicals™

Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody, Novus Biologicals™
SDP

Catalog No. NB395697 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395697 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395697 Supplier Novus Biologicals Supplier No. NBP24940225UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Cytosolic Sulfotransferase 2A1/SULT2A1 Polyclonal antibody specifically detects Cytosolic Sulfotransferase 2A1/SULT2A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Cytosolic Sulfotransferase 2A1/SULT2A1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias alcohol/hydroxysteroid sulfotransferase, Dehydroepiandrosterone sulfotransferase, DHEAS, DHEA-STbile salt sulfotransferase, EC 2.8.2.14, HST, hSTa, Hydroxysteroid Sulfotransferase, ST2, ST2A1, ST2A3, STDbile-salt sulfotranasferase 2A1, Sulfotransferase 2A1, sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone(DHEA)-preferring, member 1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIW
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6822
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.