Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154830

Catalog No. NBP154830

Description

Cytosolic Sulfotransferase 2B1/SULT2B1 Polyclonal specifically detects Cytosolic Sulfotransferase 2B1/SULT2B1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Cytosolic Sulfotransferase 2B1/SULT2B1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Alcohol sulfotransferase, EC 2.8.2, EC 2.8.2.2, HSST2sulfotransferase family cytosolic 2B member 1, Hydroxysteroid sulfotransferase 2, ST2B1, Sulfotransferase 2B1, sulfotransferase family, cytosolic, 2B, member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 6820
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O00204-2
• Gene Symbols: SULT2B1
• Immunogen: Synthetic peptides corresponding to SULT2B1(sulfotransferase family, cytosolic, 2B, member 1) The peptide sequence was selected from the N terminal of SULT2B1. Peptide sequence MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.