CYYR1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168916

Catalog No. NBP168916

Description

CYYR1 Polyclonal specifically detects CYYR1 in Rat samples. It is validated for Western Blot.

Specifications

• Antigen: CYYR1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5PQS5
• Gene Symbols: CYYR1
• Immunogen: Synthetic peptides corresponding to Cyyr1 (cysteine/tyrosine-rich 1) The peptide sequence was selected from the middle region of Cyyr1. Peptide sequence FVYAEDCRAQCGKDCRAYCCNGSTPHCCSYYAYIGSILSGTAIAGIVFGI.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 116159
• Target Species: Human, Mouse, Rat, Canine, Equine, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C21orf95, cysteine and tyrosine-rich 1, cysteine and tyrosine-rich protein 1, cysteine/tyrosine-rich 1, Proline-rich domain-containing protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 18 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.