Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CYYR1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$464.00

Specifications

Antigen	CYYR1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP168916 View Documents View Product Certificates	Novus Biologicals NBP168916	100 μL	Each of 1 for $464.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CYYR1 Polyclonal specifically detects CYYR1 in Rat samples. It is validated for Western Blot.

Specifications

Antigen	CYYR1
Classification	Polyclonal
Host Species	Rabbit
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	C21orf95, cysteine and tyrosine-rich 1, cysteine and tyrosine-rich protein 1, cysteine/tyrosine-rich 1, Proline-rich domain-containing protein
Gene Symbols	CYYR1
Isotype	IgG
Purification Method	Affinity Purified
Molecular Weight of Antigen	18 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q5PQS5
Gene ID (Entrez)	116159
Immunogen	Synthetic peptides corresponding to Cyyr1 (cysteine/tyrosine-rich 1) The peptide sequence was selected from the middle region of Cyyr1. Peptide sequence FVYAEDCRAQCGKDCRAYCCNGSTPHCCSYYAYIGSILSGTAIAGIVFGI.
Primary or Secondary	Primary
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CYYR1 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents