Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DAP Kinase 1 Antibody, Novus Biologicals™

DAP Kinase 1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1590020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1590020 20 μL
NBP159001 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1590020 Supplier Novus Biologicals Supplier No. NBP15900120UL

Description

Rabbit Polyclonal Antibody

DAP Kinase 1 Polyclonal specifically detects DAP Kinase 1 in Human samples. It is validated for Western Blot.

Specifications

Antigen DAP Kinase 1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P53355
Gene Alias DAPKDAP kinase 1, death-associated protein kinase 1, DKFZp781I035, EC 2.7.11, EC 2.7.11.1
Gene Symbols DAPK1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DAPK1(death-associated protein kinase 1) The peptide sequence was selected from the N terminal of DAPK1. Peptide sequence MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 1612
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.