DARPP-32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233534

Catalog No. NBP233534

Description

DARPP-32 Polyclonal specifically detects DARPP-32 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DARPP-32
• Classification: Polyclonal
• Dilution: Western Blot 1:100 - 1:250, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9UD71
• Gene Symbols: PPP1R1B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE
• Quantity: 0.1 mL
• Research Discipline: Breast Cancer, Neuronal Cell Markers, Neuroscience, Neurotransmission, Protein Phosphatase, Signal Transduction
• Gene ID (Entrez): 84152
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: protein phosphatase 1, regulatory (inhibitor) subunit 1B, regulatory (inhibitor) subunit 1B (dopamine and cAMPregulated phosphoprotein, DARPP-32)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only