Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Daxx Antibody, Novus Biologicals™
SDP

Catalog No. NB402759 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB402759 25 μL
NBP276512 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB402759 Supplier Novus Biologicals Supplier No. NBP27651225UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Daxx Polyclonal specifically detects Daxx in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen Daxx
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias BING2, CENP-C binding protein, DAP6MGC126245, Daxx, death domain-associated protein 6, death-associated protein 6, death-domain associated protein, EAP1, ETS1-associated protein 1, Fas death domain-associated protein, Fas-binding protein, hDaxx, MGC126246
Gene Symbols DAXX
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1616
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.