DBX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179211

Catalog No. NBP179211

Description

DBX2 Polyclonal specifically detects DBX2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DBX2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: developing brain homeobox 2, developing brain homeobox protein 2, FLJ16139, homeobox protein DBX2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 440097
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_001004329
• Gene Symbols: DBX2
• Immunogen: Synthetic peptide directed towards the middle region of human DBX2The immunogen for this antibody is DBX2. Peptide sequence SSPRWRENSPEPSERLIQESSGAPPPEANSLQGALYLCSEEEAGSKGVLT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Canine: 92%; Guinea pig: 84%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG