Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DC-SIGNR/CD299/CLEC4M Antibody, Novus Biologicals™

DC-SIGNR/CD299/CLEC4M Antibody, Novus Biologicals™
SDP

Catalog No. NBP159181 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159181 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159181 Supplier Novus Biologicals Supplier No. NBP159181
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

DC-SIGNR/CD299/CLEC4M Polyclonal specifically detects DC-SIGNR/CD299/CLEC4M in Human samples. It is validated for Western Blot.

Specifications

Antigen DC-SIGNR/CD299/CLEC4M
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H2X3
Gene Alias CD209L1, CD209Ldendritic cell-specific ICAM-3-grabbing nonintegrin 2, CD299, CD299 antigenMGC129964, C-type lectin domain family 4, member M, DC-SIGN2CD209 antigen-like protein 1, DC-SIGNRDC-SIGN-related protein, DCSIGNRMGC47866, Dendritic cell-specific ICAM-3-grabbing non-integrin 2, HP10347, liver/lymph node-specific ICAM-3 grabbing non-integrin, Liver/lymph node-specific ICAM-3-grabbing non-integrin, L-SIGN, LSIGNC-type lectin domain family 4 member M, mannose binding C-type lectin DC-SIGNR
Gene Symbols CLEC4M
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CLEC4M(C-type lectin domain family 4, member M) The peptide sequence was selected from the n terminal of CLEC4M. Peptide sequence MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 10332
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.