Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DC-STAMP/TM7SF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179329
Description
DC-STAMP/TM7SF4 Polyclonal specifically detects DC-STAMP/TM7SF4 in Human, Mouse samples. It is validated for Western Blot.Specifications
DC-STAMP/TM7SF4 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
dendritic cell-specific transmembrane protein, transmembrane 7 superfamily member 4 | |
Rabbit | |
53 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Bovine: 92%; Equine: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 84%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_110415 | |
DCSTAMP | |
Synthetic peptide directed towards the N terminal of human TM7SF4The immunogen for this antibody is TM7SF4. Peptide sequence AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW. | |
Affinity purified | |
RUO | |
81501 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction