Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DC-STAMP/TM7SF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | DC-STAMP/TM7SF4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17932920
![]() |
Novus Biologicals
NBP17932920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179329
![]() |
Novus Biologicals
NBP179329 |
100 μL |
Each for $499.50
|
|
|||||
Description
DC-STAMP/TM7SF4 Polyclonal specifically detects DC-STAMP/TM7SF4 in Human, Mouse samples. It is validated for Western Blot.Specifications
DC-STAMP/TM7SF4 | |
Polyclonal | |
Rabbit | |
NP_110415 | |
81501 | |
Synthetic peptide directed towards the N terminal of human TM7SF4The immunogen for this antibody is TM7SF4. Peptide sequence AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
dendritic cell-specific transmembrane protein, transmembrane 7 superfamily member 4 | |
DCSTAMP | |
IgG | |
53 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title