Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DC-STAMP/TM7SF4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17932920UL
Description
DC-STAMP/TM7SF4 Polyclonal specifically detects DC-STAMP/TM7SF4 in Human, Mouse samples. It is validated for Western Blot.Specifications
DC-STAMP/TM7SF4 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_110415 | |
DCSTAMP | |
Synthetic peptide directed towards the N terminal of human TM7SF4The immunogen for this antibody is TM7SF4. Peptide sequence AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW. | |
Affinity Purified | |
RUO | |
81501 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dendritic cell-specific transmembrane protein, transmembrane 7 superfamily member 4 | |
Rabbit | |
53 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction