DCAF12L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23354425UL

Catalog No. NB436850

Description

DCAF12L2 Polyclonal specifically detects DCAF12L2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DCAF12L2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q5VW00
• Gene Symbols: DCAF12L2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GLQGFEGELRGYAVQRLPELLTERQLDLGT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DDB1 And CUL4 Associated Factor 12-Like 2, DDB1- And CUL4-Associated Factor 12-Like Protein 2, WD Repeat Domain 40C, WD Repeat-Containing Protein 40C, WDR40C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 340578
• Target Species: Human
• Isotype: IgG

For Research Use Only